DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and AgaP_AGAP005704

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_315712.4 Gene:AgaP_AGAP005704 / 1276373 VectorBaseID:AGAP005704 Length:305 Species:Anopheles gambiae


Alignment Length:263 Identity:65/263 - (24%)
Similarity:124/263 - (47%) Gaps:36/263 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AVTTVGQAAPSISRVVNGTDSSVLKYPFVVSLRSYD--GSHSCGGSIISKHFVMTAAHCTNGRPA 78
            ||:::.:......|::||...:....|:..::...:  .::.|||.::|:.||:|||.|..|...
Mosquito    48 AVSSLSEGPNRSQRILNGVTVARGDIPYAAAILISEEFATYFCGGVLVSELFVLTAASCVEGDRD 112

  Fly    79 DTLSIQFGVTNISAMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFDGVSVAPVELP-- 141
            .::::......|:..| ..:.:.:||.|    |...: |||:||.:......:. ::.||.||  
Mosquito   113 LSITVLLDAAQINTAG-EFIAVSEIIVH----PAPSD-NDIALLRLNRAVRLND-NIRPVTLPNR 170

  Fly   142 ---ALAFAVPQSDAGVEGVLIGWGLNDTYGSVQDTLQEVSLKIYSDEECTSRHNGQTDP----KY 199
               .:.|....:.      :.|||  .|..:..:.|...:|::..:...::.:.|.:.|    ..
Mosquito   171 RQRTMTFVNQLAS------ISGWG--RTASNTNEALPLNNLRLVRNHVMSNFNCGVSFPFTITDQ 227

  Fly   200 HICGGVDEGGKGQCSGDSGGPL----IYNGQQ--VGIVSW-SIKPCTVAPYPGVYCKVSQYVDWI 257
            |||...|.|  ..|:||.||||    :..|:.  :|:.|: |...|.:. .|.|:.::::|:|||
Mosquito   228 HICITGDSG--SACAGDEGGPLTTVDVVTGRTFLIGLYSFTSFLGCGMG-RPTVHTRITEYLDWI 289

  Fly   258 KSN 260
            ::|
Mosquito   290 EAN 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 60/245 (24%)
Tryp_SPc 30..260 CDD:238113 61/247 (25%)
AgaP_AGAP005704XP_315712.4 Tryp_SPc 61..289 CDD:214473 60/245 (24%)
Tryp_SPc 62..292 CDD:238113 61/247 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.