DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and AgaP_AGAP012692

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_307636.4 Gene:AgaP_AGAP012692 / 1269055 VectorBaseID:AGAP012692 Length:277 Species:Anopheles gambiae


Alignment Length:234 Identity:74/234 - (31%)
Similarity:116/234 - (49%) Gaps:31/234 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QAAPSISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHC--TNGRPAD-TLSI 83
            |:...:.|:|||.::::..||::|.|| .:.:..||.|||:...|.|||||  .|..||. ||  
Mosquito    44 QSKAGLGRIVNGKNANIASYPYIVRLR-VNSAGVCGASIITYTHVFTAAHCLYKNQNPASITL-- 105

  Fly    84 QFGVTNISAMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFDGV-SVAPVELPALAFAV 147
             :|.:.....|..|....|:|.|..::|...| .|..::.::..|:  |. ::||:   ||..|.
Mosquito   106 -YGGSTSQTSGGVVFFASKVIIHPYYNPETHN-YDAGIVQIKNSFQ--GYKNIAPI---ALQDAE 163

  Fly   148 PQSDAGVEGVLIGWGLNDTYG--SVQDTLQEVSLKIYSDEECTSRHNGQTDPKYHICGGVDEGGK 210
            ..||......  |||.|: |.  :..|.||..:|::.|.::|::..:|...|:: ||...:..| 
Mosquito   164 VPSDTTCYAA--GWGYNN-YDRKTSPDNLQYATLQVISPQQCSAAWSGYATPQF-ICAQQNNNG- 223

  Fly   211 GQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCK 249
            ..|:||||||.:.|.:..|..|          |.||.|:
Mosquito   224 DVCNGDSGGPFVCNDKLTGATS----------YGGVACR 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 73/227 (32%)
Tryp_SPc 30..260 CDD:238113 72/226 (32%)
AgaP_AGAP012692XP_307636.4 Tryp_SPc 51..264 CDD:214473 73/227 (32%)
Tryp_SPc 52..274 CDD:238113 72/226 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.