DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and PRSS21

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_006790.1 Gene:PRSS21 / 10942 HGNCID:9485 Length:314 Species:Homo sapiens


Alignment Length:309 Identity:87/309 - (28%)
Similarity:129/309 - (41%) Gaps:92/309 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SLIVILAVTTVG-------QAAP---------SISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGG 58
            :|::.|.:...|       :|||         ..||:|.|.|:.:.::|:..|||.:| ||.||.
Human     6 ALLLALLLARAGLRKPESQEAAPLSGPCGRRVITSRIVGGEDAELGRWPWQGSLRLWD-SHVCGV 69

  Fly    59 SIISKHFVMTAAHCTNGRPADTLS---------IQFG-------------------VTNISAMGP 95
            |::|..:.:|||||     .:|.|         :|||                   |:|| .:.|
Human    70 SLLSHRWALTAAHC-----FETYSDLSDPSGWMVQFGQLTSMPSFWSLQAYYTRYFVSNI-YLSP 128

  Fly    96 NVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFDGVSVAPVELPALAFAVP-QSDAGVEGVLI 159
            ..:|              .:..||:|:.:..|..:. ..:.|:.|.|..|... ::|..|    .
Human   129 RYLG--------------NSPYDIALVKLSAPVTYT-KHIQPICLQASTFEFENRTDCWV----T 174

  Fly   160 GWGL--NDTYGSVQDTLQEVSLKIYSDEECTSRHNGQTDPKYH---------ICGGVDEGGKGQC 213
            |||.  .|.......|||||.:.|.::..|     .....||.         :|.|..:|||..|
Human   175 GWGYIKEDEALPSPHTLQEVQVAIINNSMC-----NHLFLKYSFRKDIFGDMVCAGNAQGGKDAC 234

  Fly   214 SGDSGGPLIYNGQ----QVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIK 258
            .|||||||..|..    |:|:|||.: .|.....||||..:|.:.:||:
Human   235 FGDSGGPLACNKNGLWYQIGVVSWGV-GCGRPNRPGVYTNISHHFEWIQ 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 78/271 (29%)
Tryp_SPc 30..260 CDD:238113 79/273 (29%)
PRSS21NP_006790.1 Tryp_SPc 42..283 CDD:238113 79/273 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.