DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and LOC103908930

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001373362.1 Gene:LOC103908930 / 103908930 -ID:- Length:243 Species:Danio rerio


Alignment Length:248 Identity:79/248 - (31%)
Similarity:126/248 - (50%) Gaps:18/248 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VILAVTTVGQAAPSISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHCTNGRP 77
            |:.|:..|..|...:.:::.|.:......|:.:.:.: ||...||.|:|::.:.::||||..|  
Zfish     4 VVFALLVVNVACSPVDKIIGGYECPPNSQPWQIYITN-DGQRWCGASLINESWAVSAAHCNIG-- 65

  Fly    78 ADTLSIQFGVTNISAMGPNVVGIK--KIIQHEDFD-PTRQNANDISLLMVEEPFEFDGVSVAPVE 139
            |:.|::..|..||..:......|:  |:..|.:|. |:..  |||.|:.:::|..|:.. |.|:.
Zfish    66 ANLLTVYLGKHNIDVVEKTEQRIRTEKVFPHPEFKFPSED--NDIMLIKLKDPAVFNQY-VQPIP 127

  Fly   140 LPALAFAVPQSDAGVEGVLIGWGLNDTYGSVQDTLQEVSLKIYSDEECTSRHNGQTDPKYHICGG 204
            |     |...|..|.:.::.|||..:.  .:...||.:.|.:.|.:||...:..:..... :|.|
Zfish   128 L-----ATSCSSEGEQCLVSGWGYTEV--GLPSVLQCLDLAVQSRQECERVYKDKFTQNM-LCAG 184

  Fly   205 VDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWI 257
            ..|||||.|.|||||||:.||:..|:|||. ..|....||.||.:|.:|.|||
Zfish   185 FMEGGKGVCHGDSGGPLVCNGELRGVVSWG-AGCAEPGYPAVYVEVCRYSDWI 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 73/230 (32%)
Tryp_SPc 30..260 CDD:238113 75/231 (32%)
LOC103908930NP_001373362.1 Tryp_SPc 21..239 CDD:238113 75/231 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.