DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and Klk5

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_038952099.1 Gene:Klk5 / 102546758 RGDID:1593461 Length:293 Species:Rattus norvegicus


Alignment Length:266 Identity:84/266 - (31%)
Similarity:131/266 - (49%) Gaps:34/266 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SNQDLSLSLIVILAVTTVGQ--AAPSISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHF 65
            :|:||:..       :..|:  .:.|.||:|||:|......|:..:|........||..:|:..:
  Rat    46 TNRDLNTD-------SNSGEDTRSDSSSRIVNGSDCPKDTQPWQGALLLGPNKLYCGAVLINPQW 103

  Fly    66 VMTAAHCTNGRPADTLSIQFGVTNISAM---GPNVV-GIKKIIQHEDFDPTRQNANDISLLMVEE 126
            ::|||||.  :|  ...|:.|..::|.:   |..:. |||. |.|..:... .::||:.|:.:..
  Rat   104 LLTAAHCR--KP--VFRIRLGHHSMSPVYESGQQMFQGIKS-IPHPGYSHP-GHSNDLMLIKMNR 162

  Fly   127 PFEFDGVSVAPVELPALAFAVPQSDAGVEG---VLIGWG-LNDTYGSVQDTLQEVSLKIYSDEEC 187
            ...... ||.|||:        .||...||   ::.||| .:.::.:....||.:.:.:.|:|.|
  Rat   163 KIRASH-SVKPVEI--------TSDCPKEGTRCMVSGWGTTSSSHNNFPKVLQCLDITVLSEERC 218

  Fly   188 TSRHNGQTDPKYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQ 252
            .:.:.||.| |...|.| ||.|:..|.||||||:|.||:..|:|||...||.....||||..:.:
  Rat   219 KNSYPGQID-KTMFCAG-DEAGRDSCQGDSGGPVICNGKLQGLVSWGDFPCAQPNRPGVYTNLCE 281

  Fly   253 YVDWIK 258
            :|.|||
  Rat   282 FVPWIK 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 75/235 (32%)
Tryp_SPc 30..260 CDD:238113 77/237 (32%)
Klk5XP_038952099.1 Tryp_SPc 67..286 CDD:214473 75/235 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.