DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and LOC101733979

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_031749509.1 Gene:LOC101733979 / 101733979 -ID:- Length:895 Species:Xenopus tropicalis


Alignment Length:271 Identity:78/271 - (28%)
Similarity:126/271 - (46%) Gaps:44/271 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AVTTVGQAAPSISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHCTNG----R 76
            |....|:..|. ||:..|:|:...::|:...|. |.|...||||:||..:::|||||.:|    |
 Frog    26 AAAVCGRQGPQ-SRIYGGSDTYPGEWPWYAMLH-YLGKPYCGGSLISNDYILTAAHCFDGDLSLR 88

  Fly    77 PADTLSIQFGVTNISAMGPN-----VVGIKKIIQHEDF----DPTRQNANDISLLMVEEPFEFDG 132
            ..::.:||.|.:.:.  ||.     ::...:|:.|||:    |     .:|::|:.:.:|..|..
 Frog    89 TPESWTIQLGSSRVG--GPPERSTLILKASQILLHEDYIHFLD-----GHDLALIKLAKPVTFTS 146

  Fly   133 VSVAPVELPALAFAVPQSDAGVEGVLIGWGLNDTYGSV----QDTLQEVSLKIYSDEECTSRHNG 193
            . |:||.||.:     |....:.......||.|....|    :.:||:|:..:...:.|...:|.
 Frog   147 F-VSPVCLPEV-----QHRFRLRRTCWALGLQDVAPGVPLDSKRSLQKVTQTLIGYKTCNCIYNS 205

  Fly   194 QTDPKY-------HICGGVDEGGKGQCSGDSGGPLIYNGQ----QVGIVSWSIKPCTVAPYPGVY 247
            ...|:.       .:|....:|.||.|.||||||::....    ..|::|:| :.|.:...|.|.
 Frog   206 HGRPELTNATLPSMLCAAESDGEKGPCLGDSGGPVVCQEDGAWFLAGVISFS-QGCHLRDSPTVL 269

  Fly   248 CKVSQYVDWIK 258
            ..||.|.||||
 Frog   270 TAVSLYQDWIK 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 71/255 (28%)
Tryp_SPc 30..260 CDD:238113 73/257 (28%)
LOC101733979XP_031749509.1 Tryp_SPc 39..282 CDD:238113 73/257 (28%)
Tryp_SPc 323..555 CDD:238113
Tryp_SPc 598..824 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.