DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and prss59.2

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001268923.1 Gene:prss59.2 / 100535672 ZFINID:ZDB-GENE-110408-10 Length:242 Species:Danio rerio


Alignment Length:259 Identity:87/259 - (33%)
Similarity:131/259 - (50%) Gaps:35/259 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SLSLIVILAVTTVGQA-APSISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAH 71
            ||..:|:|     |.| |....::|.|.:......|:..||.|  |.|.||||::|:::|::|||
Zfish     3 SLVFLVLL-----GAAFALDDDKIVGGYECQPNSQPWQASLNS--GYHFCGGSLVSEYWVVSAAH 60

  Fly    72 CTNGRPADTLSIQFGVTN--ISAMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFDGVS 134
            |...|    |.::.|..|  |:......:..:|:|::.::|....: :||.|:.:.:|...:.. 
Zfish    61 CYKSR----LEVRLGEHNIVINEGTEQFITSEKVIRNPNYDSWTID-SDIMLIKLSKPATLNKY- 119

  Fly   135 VAPVELPALAFAVPQSDAGVEGVLI---GWGLNDTYGSVQDT--LQEVSLKIYSDEECTSRHNGQ 194
            |.||.||        :....:|.:.   |||  :|..|..|:  ||.:.:.|.||.:|.:.:.|.
Zfish   120 VQPVALP--------NGCAADGTMCRVSGWG--NTMSSTADSNKLQCLEIPILSDRDCKNSYPGM 174

  Fly   195 -TDPKYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWI 257
             ||..:  |.|..||||..|.||||||::.||:..|||||.. .|.....||||.||..:..||
Zfish   175 ITDTMF--CAGYLEGGKDSCQGDSGGPVVCNGELQGIVSWGY-GCAQKDNPGVYGKVCMFSQWI 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 78/235 (33%)
Tryp_SPc 30..260 CDD:238113 80/236 (34%)
prss59.2NP_001268923.1 Tryp_SPc 20..235 CDD:214473 78/235 (33%)
Tryp_SPc 21..238 CDD:238113 80/236 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.