DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and si:ch73-182e20.4

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_009296334.2 Gene:si:ch73-182e20.4 / 100535157 ZFINID:ZDB-GENE-131127-155 Length:341 Species:Danio rerio


Alignment Length:281 Identity:92/281 - (32%)
Similarity:136/281 - (48%) Gaps:42/281 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SLSLIVILAV--------TTVGQAAPSIS-RVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISK 63
            |::|::::.|        ...|:..|.:: |:|.|.:|:...:|::||||.| |:|.||||:|:.
Zfish    40 SVTLLLLMCVRADSLSNLQVCGRPNPQLNPRIVGGLNSTEGAWPWMVSLRYY-GNHICGGSLINN 103

  Fly    64 HFVMTAAHCTNGRPADTLSIQFGVTNISAMGPNVV--GIKKIIQHEDFDPTRQNANDISLLMVEE 126
            .:|:|||||.|...::.| :..|.....|...|.:  .:..||.|..::.|..: |||:||.:..
Zfish   104 EWVLTAAHCVNLTRSNML-VYLGKWRRYAADVNEITRTVSNIIPHPSYNSTTYD-NDIALLQLSS 166

  Fly   127 PFEFDGVSVAPVELPALAFAVPQSD--AGVEGVLIGWGLNDTYG----------SV----QDTLQ 175
            ...:... :.||     ..|..||:  .|......|||.....|          ||    ...||
Zfish   167 TVHYSDY-IKPV-----CLADEQSNFPPGTRSWATGWGRIGVSGKGGIRGRTTVSVPLPPPGILQ 225

  Fly   176 EVSLKIYSDEECTSRHNGQTDPKYHICGGVDEGGKGQCSGDSGGPLIYN----GQQVGIVSWSIK 236
            ||.||:||:.:|.|..:|:.:|.. ||.|...|||...||||||||:..    ..|.|:||... 
Zfish   226 EVKLKVYSNADCNSICHGRINPNM-ICAGTRSGGKATFSGDSGGPLVSKQCSVWVQAGVVSHGY- 288

  Fly   237 PCTVAPYPGVYCKVSQYVDWI 257
            .|.....|.|:.:||:|..||
Zfish   289 GCAQPNLPEVFIRVSEYKQWI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 85/249 (34%)
Tryp_SPc 30..260 CDD:238113 86/250 (34%)
si:ch73-182e20.4XP_009296334.2 Tryp_SPc 71..309 CDD:238113 84/248 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.