DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and LOC100535114

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_009296342.3 Gene:LOC100535114 / 100535114 -ID:- Length:329 Species:Danio rerio


Alignment Length:283 Identity:90/283 - (31%)
Similarity:138/283 - (48%) Gaps:45/283 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IVILAVTTV----------GQAAPSIS-RVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHF 65
            :::|.|..|          |:..|:.: |:|.|.:::...:|::||||. .|.|.||||:|:..:
Zfish     7 VILLLVMCVRDSLSQPDVCGRPNPNFNPRIVGGVNATEGSWPWMVSLRK-SGVHFCGGSLINNQW 70

  Fly    66 VMTAAHCTNGRPADTLSIQFG-----VTNISAMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVE 125
            |:|||||.:|:...::.:..|     .|:.:.:...|:   .||.|..:: .|.:.|||:||.:.
Zfish    71 VLTAAHCISGKTTSSMHVYLGKWRRYETDQNEITRTVI---DIIPHPSYN-NRTSDNDIALLQLS 131

  Fly   126 EPFEFDGVSVAPVELPALAFAVPQSDAGVEGVLIGW---GLNDTYGSVQDT-----------LQE 176
            ...::. |.:.|:   .||........|....:.||   |::.|.|....|           |||
Zfish   132 ATVQYT-VYIKPI---CLADQNSNFPRGTRSWVTGWGRIGVSGTGGISGRTTVSVPLPAPGILQE 192

  Fly   177 VSLKIYSDEECTSRHNGQTDPKYHICGGVDEGGKGQCSGDSGGPLIYN----GQQVGIVSWSIKP 237
            |.|::||:|:|:.|..|...|.. ||.|...||||...|||||||:..    ..|.|:||... .
Zfish   193 VELQVYSNEKCSKRCQGPITPNM-ICAGTRSGGKGTFYGDSGGPLMSKQCSVWVQAGVVSHGY-G 255

  Fly   238 CTVAPYPGVYCKVSQYVDWIKSN 260
            |.....|||:.:||:|..||..|
Zfish   256 CAQPKIPGVFIRVSEYKQWITDN 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 82/250 (33%)
Tryp_SPc 30..260 CDD:238113 83/252 (33%)
LOC100535114XP_009296342.3 Tryp_SPc 36..278 CDD:238113 83/252 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.