DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and XB5892359

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_031752073.1 Gene:XB5892359 / 100497443 XenbaseID:XB-GENE-5892360 Length:426 Species:Xenopus tropicalis


Alignment Length:247 Identity:80/247 - (32%)
Similarity:136/247 - (55%) Gaps:23/247 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ISRVVNGTDSSVLKYPFVVSLRSYDGS---HSCGGSIISKHFVMTAAHC-TNGRPADTLS-IQFG 86
            :.||::|.::....:|::||::....|   |.|||::::.|:||||||| ...:...:|: |.||
 Frog    20 VRRVIDGANAQPGSWPWIVSIQMPIDSVYRHVCGGTVLNHHWVMTAAHCLLKYQSEQSLARIVFG 84

  Fly    87 VTNISAMGP--NVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFDGVSVAPVELPALAFAVPQ 149
            :.|:|.:||  .:..||::|:||.|: .::|.|||:|:.::.|..|... :.|..||..:..:.:
 Frog    85 LFNVSDLGPETQIRKIKEMIRHEHFN-KKENKNDIALIYLDRPVAFSDY-IQPACLPQQSSDITR 147

  Fly   150 SDAGVEGVLIGWGLNDTYGSVQ-DTLQEVSLKIYSDEECTSR--HNGQTDPKYHICGGVDEGGKG 211
            .:   :..:.||||.|.|..:: |.|||...::.::..|...  :||:. .:|::|.|.:.||..
 Frog   148 MN---DCYIAGWGLVDDYFRIRTDVLQEAKTELIANSRCNQSDWYNGRI-KEYNLCAGFEHGGPD 208

  Fly   212 QCSGDSGGPLIYNGQQ------VGIVSWSIKPCTVAPYPGVYCKVSQYVDWI 257
            .|.|||||||:....:      |||.||. ..|..:...|||.....:.:||
 Frog   209 TCDGDSGGPLMCKRMKAKTYYIVGIASWG-GLCGHSYRNGVYTATQYFKEWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 78/243 (32%)
Tryp_SPc 30..260 CDD:238113 79/244 (32%)
XB5892359XP_031752073.1 Tryp_SPc 22..259 CDD:214473 78/243 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.