DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and LOC100495222

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_031749236.1 Gene:LOC100495222 / 100495222 -ID:- Length:755 Species:Xenopus tropicalis


Alignment Length:273 Identity:92/273 - (33%)
Similarity:131/273 - (47%) Gaps:39/273 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ILAVTTVGQA----APSI-SRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHC- 72
            ||:..||..|    :|.: ||:|.||.:....:|:..||: |..||.||||:||..::|||||| 
 Frog   410 ILSAATVYSAPACGSPVVSSRIVGGTAAMNGAWPWQASLQ-YQYSHICGGSVISNKWIMTAAHCF 473

  Fly    73 TNGRPADTLSIQFGVTNISAMGPN--VVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFDGVSV 135
            .|........::.|...:|...||  :..:|.|..:..:: ::.|..||:|:.:.....:. ..:
 Frog   474 ENSLTTSLYRVRLGAYQLSLSSPNEFISSVKSITVNSQYN-SQTNFGDIALVELSSTITYT-TFI 536

  Fly   136 APVELPALAFAVPQSD----AGVEGVLIGWGLNDTYGS---VQDTLQEVSLKIYSDEECTSRHNG 193
            .||       .||.|.    ||:|..:.||| |..:|:   ...|||:|...:.|.:.|...::.
 Frog   537 LPV-------CVPSSSANFTAGMECWVTGWG-NIGWGAKLPYPQTLQQVMTPLISRDSCEQMYHT 593

  Fly   194 QTDPKY--------HICGGVDEGGKGQCSGDSGGPLIYNGQ----QVGIVSWSIKPCTVAPYPGV 246
            .|....        .||.|...|.|..|.|||||||:.|.|    |||||||. :.|.:|..|||
 Frog   594 STGVSSSVTIVRVDQICAGYAAGQKDSCQGDSGGPLVCNVQGVWYQVGIVSWG-EGCALANSPGV 657

  Fly   247 YCKVSQYVDWIKS 259
            |..|..|..|:.|
 Frog   658 YTLVPNYRSWLSS 670

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 83/249 (33%)
Tryp_SPc 30..260 CDD:238113 84/252 (33%)
LOC100495222XP_031749236.1 Tryp_SPc 41..279 CDD:238113
Tryp_SPc 431..670 CDD:238113 83/250 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.