DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and LOC100005420

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_021332645.1 Gene:LOC100005420 / 100005420 -ID:- Length:798 Species:Danio rerio


Alignment Length:255 Identity:81/255 - (31%)
Similarity:128/255 - (50%) Gaps:29/255 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PSISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHCTNG---RPADTLSIQFG 86
            |..||:|.|.|:...::|:..||: ..|.|.|||:::|..:|::||||.:.   .|: ..::..|
Zfish   559 PFSSRIVGGADAVEGEWPWQASLQ-IRGRHICGGALVSAQWVVSAAHCFHDDRYSPS-VWTVYLG 621

  Fly    87 VTNISAMGPN--VVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFDGVSVAPVELPALAFAVPQ 149
            ...:|:.|.:  .||:..|..|..:|....: .|::||.:..|. :.|....||       .||.
Zfish   622 KLRLSSSGQSEEAVGVSLIHLHHYYDDETHD-YDVALLRLARPV-WAGTLAQPV-------CVPP 677

  Fly   150 SDAGVEGVLI----GWGLNDTYGSVQDTLQEVSLKIYSDEECTSRHNGQTDPKYHICGGVDEGGK 210
            ....:|..|:    |||.....|:|.|.||:|.:::.|::.|...:.....|:. ||.|...|||
Zfish   678 VTHQLEPELLCWVTGWGALREGGAVSDVLQKVDVRLVSEDACVRSYGYLISPRM-ICAGYRSGGK 741

  Fly   211 GQCSGDSGGPLIYNGQQ-----VGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKSNQIISA 265
            ..|.|||||||:.....     .|:|||. :.|..|.|.|||.::::...|||  ::||:
Zfish   742 DACQGDSGGPLVCQEPSGRWFLAGVVSWG-RGCGRADYYGVYTRITKLSVWIK--RMISS 798

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 74/241 (31%)
Tryp_SPc 30..260 CDD:238113 76/243 (31%)
LOC100005420XP_021332645.1 SEA 76..169 CDD:307516
LDLa 446..476 CDD:238060
LDLa 481..512 CDD:238060
LDLa 518..553 CDD:238060
Tryp_SPc 564..794 CDD:238113 76/244 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.