DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGEA12 and MAGE

DIOPT Version :9

Sequence 1:NP_001159858.1 Gene:MAGEA12 / 4111 HGNCID:6799 Length:314 Species:Homo sapiens
Sequence 2:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster


Alignment Length:113 Identity:32/113 - (28%)
Similarity:53/113 - (46%) Gaps:9/113 - (7%)


- Green bases have known domain annotations that are detailed below.


Human   197 PKTGLLIIVLAIIAKEGDCAPEEKIWEELSVLEASDGREDSVFA-HPRKLLTQDLVQENYL--EY 258
            |:..||.|:|..|...|:...:.|::..|.:|......|...|. :.||.:.:..|::.||  |.
  Fly   111 PQFTLLYIILMYIFLRGNRIEDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRER 175

Human   259 RQVPGSDPACYEFLWGPRALVETSYVKVLHHLLKISG------GPHIS 300
            .|:...|.:...|||||||..|.::.:::....|:..      |.|:|
  Fly   176 SQLSAYDDSKTFFLWGPRAKAEFTFEQMVQFASKLLNQHPKVFGHHLS 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGEA12NP_001159858.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..72
MAGE_N 5..94 CDD:289225
MAGE 116..280 CDD:279759 27/85 (32%)
MAGENP_649702.2 MAGE 36..201 CDD:279759 28/89 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151984
Domainoid 1 1.000 63 1.000 Domainoid score I10231
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5087
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 1 1.000 - - FOG0000171
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.