DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8861 and cd59

DIOPT Version :9

Sequence 1:NP_001163567.1 Gene:CG8861 / 41109 FlyBaseID:FBgn0037676 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001313314.1 Gene:cd59 / 567192 ZFINID:ZDB-GENE-030131-7871 Length:118 Species:Danio rerio


Alignment Length:122 Identity:33/122 - (27%)
Similarity:50/122 - (40%) Gaps:15/122 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 VAIVLCSGSLGFADGLKCHMCGQYNEGVGSITPCTNYTTDIAHLYLKECTKKSEKFCVKYVSELS 118
            |.:|.....||....:||:.|..|......|..|  |..| |.|.:.|....:.:.|:||     
Zfish     7 VCVVFVLALLGLGSAIKCYNCKDYTGACSKIKDC--YYDD-ACLSVYERGGDTYRQCIKY----- 63

  Fly   119 TVRDCATECVEKEIWETQTY---CCTEDGCNSG--TQLAYSVILLTLPILSVAWPTF 170
              .:|....|..:..:..::   |||.|.|||.  :..:.||:.:.||:....|..|
Zfish    64 --SECDYSTVGVKFPKLSSFKFSCCTSDLCNSAPLSVSSRSVVAILLPLALFWWGVF 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8861NP_001163567.1 None
cd59NP_001313314.1 LU 24..95 CDD:299177 22/80 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1586315at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.