| Sequence 1: | NP_001163567.1 | Gene: | CG8861 / 41109 | FlyBaseID: | FBgn0037676 | Length: | 178 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001343771.1 | Gene: | F55C12.19 / 34700631 | WormBaseID: | WBGene00271817 | Length: | 123 | Species: | Caenorhabditis elegans |
| Alignment Length: | 131 | Identity: | 30/131 - (22%) |
|---|---|---|---|
| Similarity: | 51/131 - (38%) | Gaps: | 33/131 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 51 AILVAIVLCSGSLGFADG-LKCHMCGQYNEGVGSITPCTNYTTDIAHLYLKECTKKSEKFCVK-- 112
Fly 113 ----------YVSELSTVRDCATECVEKEIWETQTYCCTEDGCNSG---TQLAYSVILLTLPILS 164
Fly 165 V 165 |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1586315at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.010 | |||||