DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8861 and B0222.15

DIOPT Version :9

Sequence 1:NP_001163567.1 Gene:CG8861 / 41109 FlyBaseID:FBgn0037676 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001294772.1 Gene:B0222.15 / 24104107 WormBaseID:WBGene00235316 Length:116 Species:Caenorhabditis elegans


Alignment Length:92 Identity:22/92 - (23%)
Similarity:30/92 - (32%) Gaps:30/92 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 CGQYNEGVGSIT-PCTNYTTDIAHLYLKECTKKSEKFCVKYVSELSTVRDCATECVEKEIWETQT 137
            |.:..|..|..| .|.::|                .||.|            .|||... .:::.
 Worm    48 CIKTTEPTGGATYGCDDFT----------------PFCKK------------DECVVTS-KQSKV 83

  Fly   138 YCCTEDGCNSGTQLAYSVILLTLPILS 164
            .||..|.|||.....:.|.||...:.|
 Worm    84 CCCNTDLCNSSPITFWPVSLLFFILFS 110



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1586315at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.