Sequence 1: | NP_001163567.1 | Gene: | CG8861 / 41109 | FlyBaseID: | FBgn0037676 | Length: | 178 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001381953.1 | Gene: | Ly6k / 100363492 | RGDID: | 2322953 | Length: | 179 | Species: | Rattus norvegicus |
Alignment Length: | 135 | Identity: | 30/135 - (22%) |
---|---|---|---|
Similarity: | 47/135 - (34%) | Gaps: | 43/135 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 50 LAILVAIVLCSGSLGFAD---GLKCHMCGQYNEGVGSITPCTNYTTDIAHLYLKECTKKSEKFCV 111
Fly 112 KYVSEL-----STVRDCATEC------------------VEKEIWETQTYCCTEDGCNSGTQLAY 153
Fly 154 SVILL 158 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1586315at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |