DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1e and Oxp

DIOPT Version :10

Sequence 1:NP_649878.1 Gene:HP1e / 41108 FlyBaseID:FBgn0037675 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster


Alignment Length:83 Identity:29/83 - (34%)
Similarity:44/83 - (53%) Gaps:9/83 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SENSTDF--------EETEEYIVERILDRRHYMGQLQYLVKWLDYSDEDNTWESAADL-DCHSLI 70
            |:.|.|.        |::.|||||:.|.:|:..|:.|||.||..|..|..|||...:| .|.:||
  Fly     2 SQKSIDLGLGVRNVKEKSSEYIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLI 66

  Fly    71 DSIESQKSLKRGQELNNQ 88
            ...|::...:..::.|:|
  Fly    67 ADYEAELFQQSREKKNDQ 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1eNP_649878.1 CD_CSD 27..71 CDD:349274 20/44 (45%)
CSD_HP1e_insect 111..163 CDD:349337
OxpNP_611240.1 CD_Rhino 21..71 CDD:349280 22/49 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.