DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1e and HP6

DIOPT Version :10

Sequence 1:NP_649878.1 Gene:HP1e / 41108 FlyBaseID:FBgn0037675 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_608842.1 Gene:HP6 / 33661 FlyBaseID:FBgn0031613 Length:106 Species:Drosophila melanogaster


Alignment Length:60 Identity:20/60 - (33%)
Similarity:33/60 - (55%) Gaps:0/60 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 FNHGFTAQEILKGAKNNGEISFLIRFWHLDQPQVVPSGIAYVEIPQMVLKFYENHCNFHD 167
            |:.|.....||.....:|:::||:::...|:..:||:.:..|..||||:.|||....|.|
  Fly    20 FDLGLEPLRILGACNWSGKLTFLMQWKGCDEAGLVPAEVLNVRCPQMVISFYEERIVFTD 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1eNP_649878.1 CD_CSD 27..71 CDD:349274
CSD_HP1e_insect 111..163 CDD:349337 17/51 (33%)
HP6NP_608842.1 CSD 24..75 CDD:349275 16/50 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.