DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1e and CG8289

DIOPT Version :10

Sequence 1:NP_649878.1 Gene:HP1e / 41108 FlyBaseID:FBgn0037675 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_573229.1 Gene:CG8289 / 32741 FlyBaseID:FBgn0030854 Length:336 Species:Drosophila melanogaster


Alignment Length:89 Identity:23/89 - (25%)
Similarity:49/89 - (55%) Gaps:5/89 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SENSTDFEETEEYIVERILDRRHYMGQLQYLVKWLDYSDEDNTWESAADLDCHSLIDSIESQKSL 79
            :::|.|.|  :::.||:|||.........:.::|..|..:|::||.:.:|.|.:||:....:::.
  Fly   223 ADDSIDPE--KQWEVEKILDHVATKEGDMFKIRWKKYGPKDDSWEPSKNLACDALIEKFMRKQAT 285

  Fly    80 KRGQELNNQYET--KAKRLKIDPC 101
            :...::....|:  |.:|| :|.|
  Fly   286 QENVDVKELRESPKKTERL-VDEC 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1eNP_649878.1 CD_CSD 27..71 CDD:349274 13/43 (30%)
CSD_HP1e_insect 111..163 CDD:349337
CG8289NP_573229.1 CD_CSD 233..281 CDD:349274 14/47 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.