DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1e and Cbx6

DIOPT Version :10

Sequence 1:NP_649878.1 Gene:HP1e / 41108 FlyBaseID:FBgn0037675 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001387975.1 Gene:Cbx6 / 315136 RGDID:1307314 Length:414 Species:Rattus norvegicus


Alignment Length:110 Identity:29/110 - (26%)
Similarity:49/110 - (44%) Gaps:17/110 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 YIVERILDRRHYMGQLQYLVKWLDYSDEDNTWESAADLDCHSLIDSIESQK-------SLKRGQE 84
            :..|.|:.||...|:::|||||..::.:.:|||...::....||.:.|.::       ..|||.:
  Rat    11 FAAESIIKRRIRKGRIEYLVKWKGWAIKYSTWEPEENILDSRLIAAFEQKERERELYGPKKRGPK 75

  Fly    85 -----LNNQYETKAKRL-----KIDPCLVVDSPFNHGFTAQEILK 119
                 |..:.:.:|.|:     .:.|.....||..|...|...||
  Rat    76 PKTFLLKARAQAEALRISDVHFSVKPSASASSPKLHSSAAVHRLK 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1eNP_649878.1 CD_CSD 27..71 CDD:349274 14/43 (33%)
CSD_HP1e_insect 111..163 CDD:349337 3/9 (33%)
Cbx6NP_001387975.1 CD_Cbx6 8..65 CDD:349295 16/53 (30%)
CBX7_C 359..390 CDD:465385
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.