DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1e and cec-4

DIOPT Version :10

Sequence 1:NP_649878.1 Gene:HP1e / 41108 FlyBaseID:FBgn0037675 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_501231.1 Gene:cec-4 / 177536 WormBaseID:WBGene00017990 Length:270 Species:Caenorhabditis elegans


Alignment Length:84 Identity:28/84 - (33%)
Similarity:38/84 - (45%) Gaps:10/84 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 EETEEYIVERILDRRHYMGQLQYLVKWLDYSD---EDNTWESAADLD-CHSLIDSIES-QKSLKR 81
            :.:.||.|||:|..|...|...|||:|..|..   ....||.  ||| |..|:.:.:. |:.||.
 Worm    82 DSSGEYAVERVLAHRKVKGSPLYLVQWKGYPHPVWNSEMWEE--DLDNCKDLLAAYKKHQEDLKI 144

  Fly    82 GQELNNQYETKAKRLKIDP 100
            .|   ...:|.:|..|..|
 Worm   145 AQ---TPKKTPSKTPKKTP 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1eNP_649878.1 CD_CSD 27..71 CDD:349274 19/47 (40%)
CSD_HP1e_insect 111..163 CDD:349337
cec-4NP_501231.1 CD_CEC-4_like 87..137 CDD:349317 19/51 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.