DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1e and Cdyl

DIOPT Version :10

Sequence 1:NP_649878.1 Gene:HP1e / 41108 FlyBaseID:FBgn0037675 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_034011.1 Gene:Cdyl / 12593 MGIID:1339956 Length:593 Species:Mus musculus


Alignment Length:81 Identity:30/81 - (37%)
Similarity:41/81 - (50%) Gaps:10/81 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TVSNFSENSTDFEETEEYIVERILD-RRHYMGQLQYLVKWLDYSDEDNTWESAADL-DCHSLIDS 72
            |||...:.|...::.|.. ||.|:| |::..|:.:|||:|..|..||:|||....| :|...|..
Mouse    40 TVSEPDQASPAIQDAETQ-VESIVDKRKNKKGKTEYLVRWKGYDSEDDTWEPEQHLVNCEEYIHD 103

  Fly    73 I-----ESQK--SLKR 81
            .     |.||  ||.|
Mouse   104 FNRRHNERQKEGSLAR 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1eNP_649878.1 CD_CSD 27..71 CDD:349274 18/45 (40%)
CSD_HP1e_insect 111..163 CDD:349337
CdylNP_034011.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
Interaction with EZH2. /evidence=ECO:0000250|UniProtKB:Q9Y232 56..304 25/65 (38%)
CD_CDY 57..106 CDD:349284 19/49 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 110..158 6/10 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..223
crotonase-like 339..535 CDD:119339
Acetyl-CoA-binding domain. /evidence=ECO:0000255 357..589
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.