DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps16A and caprin2

DIOPT Version :9

Sequence 1:NP_649877.1 Gene:Vps16A / 41107 FlyBaseID:FBgn0285911 Length:833 Species:Drosophila melanogaster
Sequence 2:XP_002942296.3 Gene:caprin2 / 100145510 XenbaseID:XB-GENE-1014055 Length:1012 Species:Xenopus tropicalis


Alignment Length:250 Identity:44/250 - (17%)
Similarity:83/250 - (33%) Gaps:91/250 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   322 ITQSSHEIIQRLPKCVENI-FAVNSQEPASYLFEAQKKFEEKSYKSDEYLSMCREKIDLAVSECI 385
            :.|...|.:::..:.|.|: ||...|:..|.|.:...|.::|:.:.:..|.:..||..|      
 Frog    85 LNQDQQEAVEKYEEVVHNLDFARELQKTFSALSQDLLKAQKKALRREHLLKVEAEKKRL------ 143

  Fly   386 EAASYEFCPETQKSLLRTAYFGKGFIRNHNPDEYMRIMRILRVLNTLRHERIAMPITFKQFSHLN 450
                        |::|:..|......::|...::.            .....|:.::.|...|| 
 Frog   144 ------------KAILQVQYMLHALCQDHVQKDFK------------EGSNGAVSLSPKDTDHL- 183

  Fly   451 TEVILSRLVFRKHYAIAIQVAKHLNLPES--------WILEHWAYHKVMNDPNDTEVARKITEKF 507
              |..::|..:|.|       .|::|.:.        |              |..|.:.|     
 Frog   184 --VKFAKLTCQKRY-------PHMSLEDQMDQASICLW--------------NLFESSEK----- 220

  Fly   508 KNPSVEGISFCNIASKAHQAGRDDLAIKLLE-----------LESRASLHVPLLL 551
               :|.|.|:..:         .:|..|||:           :|.....|:|.:|
 Frog   221 ---TVAGTSYKYL---------KELVTKLLDCGYFENVPEAPVEKAKEKHIPEVL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps16ANP_649877.1 Vps16_N 6..421 CDD:252829 19/99 (19%)
Vps16_C 515..829 CDD:282668 8/47 (17%)
caprin2XP_002942296.3 Caprin-1_dimer 129..244 CDD:408102 29/185 (16%)
Caprin-1_C 477..816 CDD:403488
C1q 884..1009 CDD:395310
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 256 1.000 Domainoid score I2003
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 519 1.000 Inparanoid score I1252
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004640
OrthoInspector 1 1.000 - - oto103215
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1643
SonicParanoid 1 1.000 - - X3256
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.080

Return to query results.
Submit another query.