DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sage and olig4

DIOPT Version :9

Sequence 1:NP_524287.1 Gene:sage / 41105 FlyBaseID:FBgn0037672 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001039180.1 Gene:olig4 / 734024 XenbaseID:XB-GENE-484736 Length:209 Species:Xenopus tropicalis


Alignment Length:181 Identity:46/181 - (25%)
Similarity:65/181 - (35%) Gaps:64/181 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 APTHPHSYSPSVMGGYEKEAHNMG-LLPPTYSVIPQPVSMWHAGQVATGSPVGLECNKPSELVPP 142
            :|......||..:.|...:||::| .:||             .|:|..|.               
 Frog    12 SPEFDRGESPQFLSGAMFQAHSVGQRMPP-------------RGRVKAGK--------------- 48

  Fly   143 PMYMSYSGGSIANSTEVDIAKEHNPAWREKALQMEKDYRRTACDRERTRMRDMNRAFDLLRSKLP 207
                                       ||...:.:.:.|.....|||.||.|:|:|.|.||..:|
 Frog    49 ---------------------------RELTQENQHELRLKVNSRERQRMHDLNQAMDGLREVMP 86

  Fly   208 ISK-PNGKKYSKIESLRIAINYI----NHLQAMLR---ESSVGQNGNGCCA 250
            .|. |:.:|.|||.:|.:|.|||    |.|:.|.|   |....|...||.:
 Frog    87 YSHGPSVRKLSKISTLILARNYIVMLSNSLEEMKRLVNEVYGAQRAPGCAS 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sageNP_524287.1 HLH 181..233 CDD:278439 25/56 (45%)
olig4NP_001039180.1 bHLH_TS_OLIG2_like 59..121 CDD:381568 27/61 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.