DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sage and NEUROD6

DIOPT Version :9

Sequence 1:NP_524287.1 Gene:sage / 41105 FlyBaseID:FBgn0037672 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_073565.2 Gene:NEUROD6 / 63974 HGNCID:13804 Length:337 Species:Homo sapiens


Alignment Length:130 Identity:41/130 - (31%)
Similarity:56/130 - (43%) Gaps:26/130 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 ECNKPSELVPPPMY---MSYSGGSIANSTEVDIAKEHNPAWREK--------------------A 173
            ||....::..|..:   :...|.||..:...:..||.....||:                    .
Human    24 ECEDQKQIKKPESFSKQIVLRGKSIKRAPGEETEKEEEEEDREEEDENGLPRRRGLRKKKTTKLR 88

  Fly   174 LQMEKDYRRTACDRERTRMRDMNRAFDLLRSKLP-ISKPNGKKYSKIESLRIAINYINHLQAMLR 237
            |:..|..|:.|..|||.||..:|.|.|.||..:| .||.  :|.||||:||:|.|||..|..:||
Human    89 LERVKFRRQEANARERNRMHGLNDALDNLRKVVPCYSKT--QKLSKIETLRLAKNYIWALSEILR 151

  Fly   238  237
            Human   152  151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sageNP_524287.1 HLH 181..233 CDD:278439 26/52 (50%)
NEUROD6NP_073565.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 43..82 7/38 (18%)
Nuclear localization signal. /evidence=ECO:0000255 80..86 0/5 (0%)
bHLH_TS_NeuroD6_ATOH2 82..151 CDD:381565 29/70 (41%)
Neuro_bHLH 153..272 CDD:403655
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.