DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sage and NEUROG2

DIOPT Version :9

Sequence 1:NP_524287.1 Gene:sage / 41105 FlyBaseID:FBgn0037672 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_076924.1 Gene:NEUROG2 / 63973 HGNCID:13805 Length:272 Species:Homo sapiens


Alignment Length:285 Identity:69/285 - (24%)
Similarity:96/285 - (33%) Gaps:108/285 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 EQPVLLELGAPQSSSCPAVSLNYTLTADGAGLLAYAPTHPHSYSPSVMGGYEKEAHNMGLLPPTY 108
            |:.||:.||    |:.||::   .||.     |:.:........|...||..::...        
Human    13 EEDVLVLLG----SASPALA---ALTP-----LSSSADEEEEEEPGASGGARRQRGA-------- 57

  Fly   109 SVIPQPVSMWHAGQVATGS-PVGLECNKPSELV--------PPPMYMSYSGGSIANSTEVDIAKE 164
                      .|||.|.|. ..|.|..:|:.|:        .|....:.|.|          ||.
Human    58 ----------EAGQGARGGVAAGAEGCRPARLLGLVHDCKRRPSRARAVSRG----------AKT 102

  Fly   165 HNPAWREKALQMEKDYRRTACDRERTRMRDMNRAFDLLRSKLPISKPNGKKYSKIESLRIAINYI 229
                 .|...:::|..|..|.:|||.||.::|.|.|.||..|| :.|...|.:|||:||.|.|||
Human   103 -----AETVQRIKKTRRLKANNRERNRMHNLNAALDALREVLP-TFPEDAKLTKIETLRFAHNYI 161

  Fly   230 NHLQAMLR-------------------------------ESSVGQNGNGCCAW------------ 251
            ..|...||                               .||.|.:.:....|            
Human   162 WALTETLRLADHCGGGGGGLPGALFSEAVLLSPGGASAALSSSGDSPSPASTWSCTNSPAPSSSV 226

  Fly   252 SGGSSSPYD----------NGNDHW 266
            |..|:|||.          :..|:|
Human   227 SSNSTSPYSCTLSPASPAGSDMDYW 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sageNP_524287.1 HLH 181..233 CDD:278439 25/51 (49%)
NEUROG2NP_076924.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..69 11/61 (18%)
bHLH_TS_NGN2_ATOH4 104..172 CDD:381560 30/68 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..264 11/55 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.