Sequence 1: | NP_524287.1 | Gene: | sage / 41105 | FlyBaseID: | FBgn0037672 | Length: | 268 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_076924.1 | Gene: | NEUROG2 / 63973 | HGNCID: | 13805 | Length: | 272 | Species: | Homo sapiens |
Alignment Length: | 285 | Identity: | 69/285 - (24%) |
---|---|---|---|
Similarity: | 96/285 - (33%) | Gaps: | 108/285 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 44 EQPVLLELGAPQSSSCPAVSLNYTLTADGAGLLAYAPTHPHSYSPSVMGGYEKEAHNMGLLPPTY 108
Fly 109 SVIPQPVSMWHAGQVATGS-PVGLECNKPSELV--------PPPMYMSYSGGSIANSTEVDIAKE 164
Fly 165 HNPAWREKALQMEKDYRRTACDRERTRMRDMNRAFDLLRSKLPISKPNGKKYSKIESLRIAINYI 229
Fly 230 NHLQAMLR-------------------------------ESSVGQNGNGCCAW------------ 251
Fly 252 SGGSSSPYD----------NGNDHW 266 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sage | NP_524287.1 | HLH | 181..233 | CDD:278439 | 25/51 (49%) |
NEUROG2 | NP_076924.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 30..69 | 11/61 (18%) | |
bHLH_TS_NGN2_ATOH4 | 104..172 | CDD:381560 | 30/68 (44%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 197..264 | 11/55 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3898 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |