DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sage and Neurog3

DIOPT Version :9

Sequence 1:NP_524287.1 Gene:sage / 41105 FlyBaseID:FBgn0037672 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_067732.1 Gene:Neurog3 / 60329 RGDID:631350 Length:214 Species:Rattus norvegicus


Alignment Length:203 Identity:56/203 - (27%)
Similarity:84/203 - (41%) Gaps:46/203 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 APTHPHSYSPSVM----------GGYEKEAHNMGLLPPTYSVIPQPVSMWHAGQVATGSPVGLEC 133
            || ||.. :|::.          |..:.|..:....||:.:::|:..|...||          :|
  Rat     2 AP-HPLD-APTIQVSQETQQPFPGASDHEVLSSNSTPPSPTLVPRDCSEAEAG----------DC 54

  Fly   134 NKPSELVPPPMYMSYSGGSIANSTEVDIAKEHNPAWREKALQMEKDYRRTACDRERTRMRDMNRA 198
            ...|..:     .:..||.....:|:.::|:            .:..|:.|.||||.||.::|.|
  Rat    55 RGTSRKL-----RARRGGRNRPKSELALSKQ------------RRSRRKKANDRERNRMHNLNSA 102

  Fly   199 FDLLRSKLPISKPNGKKYSKIESLRIAINYINHLQAMLR---ESSVGQNGNGCCAWSGGSSSPYD 260
            .|.||..|| :.|:..|.:|||:||.|.|||..|...||   .|..|......|   |...||..
  Rat   103 LDALRGVLP-TFPDDAKLTKIETLRFAHNYIWALTQTLRIADHSFYGPEPPVPC---GELGSPGG 163

  Fly   261 NGNDHWGA 268
            ..:..||:
  Rat   164 GSSGDWGS 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sageNP_524287.1 HLH 181..233 CDD:278439 26/51 (51%)
Neurog3NP_067732.1 bHLH_TS_NGN3_ATOH5 77..144 CDD:381561 30/79 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.