DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sage and Bhlhe22

DIOPT Version :9

Sequence 1:NP_524287.1 Gene:sage / 41105 FlyBaseID:FBgn0037672 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_067535.3 Gene:Bhlhe22 / 59058 MGIID:1930001 Length:355 Species:Mus musculus


Alignment Length:279 Identity:71/279 - (25%)
Similarity:94/279 - (33%) Gaps:102/279 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLSSTAGVPGDPPPVLVPVSAT---TGGPYLSGGSEGEAESSEQ----------PVLLELGAPQS 56
            ||..:|||.|:|....:|..|.   ..|.....||..|:...||          .::|..|.|..
Mouse    97 LLVGSAGVGGEPSLSSLPAGAALCLKYGESAGRGSVAESSGGEQSPDDDSDGRCELVLRAGGPDP 161

  Fly    57 SSCPAVSLNYTLTADGAGLLAYAPTHPHSYSPSVMGGYEKEA--------HNMGLLPPTYSVIPQ 113
            .:.|           |||                 ||..|.|        |....|||       
Mouse   162 RASP-----------GAG-----------------GGSAKVAEGCSNAHLHGGSGLPP------- 191

  Fly   114 PVSMWHAGQVATGSPVGLECNKPSELVPPPMYMSYSGGSIANSTEVDIAKEHNPAWREKALQMEK 178
                  .|..:.|...|                 ..|||...|.|            :|||::..
Mouse   192 ------GGPTSGGGSGG-----------------GGGGSSKKSKE------------QKALRLNI 221

  Fly   179 DYRRTACDRERTRMRDMNRAFDLLRSKLPIS-KPNGKKYSKIESLRIAINYI----NHLQAMLRE 238
            :      .|||.||.|:|.|.|.||:.:|.: .|:.:|.|||.:|.:|.|||    ..|:.|.|.
Mouse   222 N------ARERRRMHDLNDALDELRAVIPYAHSPSVRKLSKIATLLLAKNYILMQAQALEEMRRL 280

  Fly   239 SSVGQNGNGCCAWSGGSSS 257
            .:....|....|.|..||:
Mouse   281 VAYLNQGQAISAASLPSSA 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sageNP_524287.1 HLH 181..233 CDD:278439 22/56 (39%)
Bhlhe22NP_067535.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..90
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..215 28/156 (18%)
HLH 222..276 CDD:197674 23/59 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.