DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sage and mespba

DIOPT Version :9

Sequence 1:NP_524287.1 Gene:sage / 41105 FlyBaseID:FBgn0037672 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_571627.1 Gene:mespba / 58070 ZFINID:ZDB-GENE-000406-9 Length:236 Species:Danio rerio


Alignment Length:133 Identity:42/133 - (31%)
Similarity:62/133 - (46%) Gaps:13/133 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 ECNKPSELVPPPMYMSYSGGSIANSTEVDIAKEHNPAWREKALQMEKDYRRTACDRERTRMRDMN 196
            |...|.:...||.........:..|:.:...|      |...|:...:.|:.|.::|:.||||:.
Zfish    25 ETTSPDQSFSPPHQTKPPCSKLVKSSNIMRKK------RRLRLKNPSERRQNASEKEKLRMRDLT 83

  Fly   197 RAFDLLRSKLPIS-KPNGKKYSKIESLRIAINYINHL--QAMLRESSVG----QNGNGCCAWSGG 254
            :|...|||.||.| .|.|:..:|||:||:.|.||:.|  |..|.|..:.    :|.:||...|..
Zfish    84 KALHHLRSFLPASVAPVGQTLTKIETLRLTIQYISFLSSQLGLSEEELSYRRQENSSGCSLSSFE 148

  Fly   255 SSS 257
            .||
Zfish   149 CSS 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sageNP_524287.1 HLH 181..233 CDD:278439 25/54 (46%)
mespbaNP_571627.1 HLH 67..120 CDD:278439 24/52 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170584016
Domainoid 1 1.000 54 1.000 Domainoid score I11202
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24509
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.