DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sage and mespaa

DIOPT Version :9

Sequence 1:NP_524287.1 Gene:sage / 41105 FlyBaseID:FBgn0037672 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_571626.1 Gene:mespaa / 58069 ZFINID:ZDB-GENE-000406-8 Length:223 Species:Danio rerio


Alignment Length:205 Identity:56/205 - (27%)
Similarity:85/205 - (41%) Gaps:60/205 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 SLNYTLTADGAGLLAYAPTHPHSYSPSVMGGYEKEAHNMGLLPPTYSVIPQ--PVSMWHAGQVAT 125
            |.|.:.....||.  |:.|  .|.||:      ....:....||.||::||  |.|:        
Zfish    20 SQNQSFAVSDAGY--YSAT--GSLSPT------SSIDSCSFSPPAYSLLPQIFPKSI-------- 66

  Fly   126 GSPVGLECNKPSELVPPPMYMSYSGGSIANSTEVDIAKEHNPAWREKALQMEKDYRRTACDRERT 190
                     :.:::.||                   .:...|..:...::     |:||.:||:.
Zfish    67 ---------QKTDVQPP-------------------KRTGRPKSKFPGVK-----RQTASEREKL 98

  Fly   191 RMRDMNRAFDLLRSKLPIS-KPNGKKYSKIESLRIAINYINHLQAMLRESSVGQNGNGCCAWS-- 252
            ||||:.:|...||:.||.| .|.||..:|||:||:||.||:.|...|   ..|::...|.|..  
Zfish    99 RMRDLTKALHHLRTFLPASVAPVGKTLTKIETLRLAIQYISCLSDQL---GCGEDVEICEAQDEV 160

  Fly   253 -GGSSSPYDN 261
             ..|:|.:||
Zfish   161 ISTSASVFDN 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sageNP_524287.1 HLH 181..233 CDD:278439 27/52 (52%)
mespaaNP_571626.1 HLH 88..141 CDD:278439 27/57 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170584020
Domainoid 1 1.000 54 1.000 Domainoid score I11202
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24509
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.