Sequence 1: | NP_524287.1 | Gene: | sage / 41105 | FlyBaseID: | FBgn0037672 | Length: | 268 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001025304.1 | Gene: | bhlhe23 / 559796 | ZFINID: | ZDB-GENE-050913-22 | Length: | 227 | Species: | Danio rerio |
Alignment Length: | 202 | Identity: | 53/202 - (26%) |
---|---|---|---|
Similarity: | 74/202 - (36%) | Gaps: | 59/202 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 121 GQVATGSPVGLECNKPS--ELVPPPMYMS-------YSGGSIANSTEVD-------------IAK 163
Fly 164 EHNPAWREKALQMEKDYRRTACDRERTRMRDMNRAFDLLRSKLPIS-KPNGKKYSKIESLRIAIN 227
Fly 228 YI----------NHLQAMLRESSV------------GQN-------------GNGCCAWSGGSSS 257
Fly 258 PYDNGND 264 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sage | NP_524287.1 | HLH | 181..233 | CDD:278439 | 24/62 (39%) |
bhlhe23 | NP_001025304.1 | HLH | 110..164 | CDD:197674 | 23/53 (43%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3898 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |