DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sage and bhlhe23

DIOPT Version :9

Sequence 1:NP_524287.1 Gene:sage / 41105 FlyBaseID:FBgn0037672 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001025304.1 Gene:bhlhe23 / 559796 ZFINID:ZDB-GENE-050913-22 Length:227 Species:Danio rerio


Alignment Length:202 Identity:53/202 - (26%)
Similarity:74/202 - (36%) Gaps:59/202 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 GQVATGSPVGLECNKPS--ELVPPPMYMS-------YSGGSIANSTEVD-------------IAK 163
            ||.|.|...|.....|.  .|.|...::|       .|||. ..|.|.|             ..:
Zfish    25 GQSAFGFGAGHGAGSPGRFSLTPAADFLSGQTGKSNESGGE-QTSDEDDGFDNLESRKRGAGFDE 88

  Fly   164 EHNPAWREKALQMEKDYRRTACDRERTRMRDMNRAFDLLRSKLPIS-KPNGKKYSKIESLRIAIN 227
            |.:|....|..:.::..|.:...|||.||.|:|.|.|.|||.:|.: .|:.:|.|||.:|.:|.|
Zfish    89 EKHPGSLTKKSKEQRSLRLSINARERRRMHDLNDALDGLRSVIPYAHSPSVRKLSKIATLLLAKN 153

  Fly   228 YI----------NHLQAMLRESSV------------GQN-------------GNGCCAWSGGSSS 257
            ||          ..|.|.|.:...            ||.             ...|.::||..|:
Zfish   154 YILMQAQALEEMRRLVAYLNQGQTITSPIPTALAPFGQAAVYPFSSTALATCAEKCNSFSGTPSN 218

  Fly   258 PYDNGND 264
            .:.:.||
Zfish   219 LFKHCND 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sageNP_524287.1 HLH 181..233 CDD:278439 24/62 (39%)
bhlhe23NP_001025304.1 HLH 110..164 CDD:197674 23/53 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.