DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sage and MESP1

DIOPT Version :9

Sequence 1:NP_524287.1 Gene:sage / 41105 FlyBaseID:FBgn0037672 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_061140.1 Gene:MESP1 / 55897 HGNCID:29658 Length:268 Species:Homo sapiens


Alignment Length:208 Identity:58/208 - (27%)
Similarity:85/208 - (40%) Gaps:61/208 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 CPAVSLNYTLTADGAGLLAYAPTHPHSYSPSVMGGYEKEAHNMGLLPPT-----YSVIPQPVSMW 118
            ||.:|.::.|:|      |:.||.    .|                ||:     .|::..|.| |
Human     6 CPPLSESWMLSA------AWGPTR----RP----------------PPSDKDCGRSLVSSPDS-W 43

  Fly   119 HAGQVATGSPVGLECNKPSELVPPPMYMSYSGGSIANSTEVDIAKEHNPAWREKALQMEKDYRRT 183
              |.....|||.... :|..|..|........|:                   ::.::....|::
Human    44 --GSTPADSPVASPA-RPGTLRDPRAPSVGRRGA-------------------RSSRLGSGQRQS 86

  Fly   184 ACDRERTRMRDMNRAFDLLRSKLPIS-KPNGKKYSKIESLRIAINYINHLQAM--LRESSVGQNG 245
            |.:||:.|||.:.||...||..||.| .|.|:..:|||:||:||.||.||.|:  |.|.|:.:. 
Human    87 ASEREKLRMRTLARALHELRRFLPPSVAPAGQSLTKIETLRLAIRYIGHLSAVLGLSEESLQRR- 150

  Fly   246 NGCCAWSGGSSSP 258
               |...|.:.||
Human   151 ---CRQRGDAGSP 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sageNP_524287.1 HLH 181..233 CDD:278439 26/52 (50%)
MESP1NP_061140.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 17..93 23/124 (19%)
bHLH_TS_Mesp 83..147 CDD:381508 30/63 (48%)
CPLCP 163..167
2 X 2 AA tandem repeats of G-Q 182..185
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149877
Domainoid 1 1.000 49 1.000 Domainoid score I11802
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5450
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.