DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sage and Atoh8

DIOPT Version :9

Sequence 1:NP_524287.1 Gene:sage / 41105 FlyBaseID:FBgn0037672 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001102711.1 Gene:Atoh8 / 500200 RGDID:1561512 Length:322 Species:Rattus norvegicus


Alignment Length:256 Identity:71/256 - (27%)
Similarity:94/256 - (36%) Gaps:65/256 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SSTAGVPG-----DPPPVLVPVSATTGGPYLSGGSEGEAESSEQPVLLELGAPQSSSCPAVSLNY 66
            |:||...|     .|.|:..||.|:.......||....|..     ...:.||:.|.  |....:
  Rat    57 SATAATNGLRDRTQPFPIATPVPASVAPAVPPGGGTDTARE-----FRGIRAPEVSD--ARKRGF 114

  Fly    67 TLTADGAGLLAYAPTHP-----HSYSPSVMGGYEKEAHNMGLLPPTYSVIPQPVSMWHAGQVATG 126
            .|...|.||    ||.|     .|.:|   |..|.:......|.|...:...|.....:..:|  
  Rat   115 ALGTVGPGL----PTPPPPPASQSLAP---GDPEVQPLREQALRPRILLCAPPARPTPSAPLA-- 170

  Fly   127 SPVGLECNKPSELVPP--PMYMSYS---------------------GGSIANSTEVDIAKEHNPA 168
             |..:....|....||  |...|||                     |.:.|.|||:         
  Rat   171 -PPAVPQESPVRPAPPTRPGESSYSSISHVIYNNHPDSSASPRKRPGEATAASTEI--------- 225

  Fly   169 WREKALQMEKDYRRTACDRERTRMRDMNRAFDLLRSKLPISKPNGKKYSKIESLRIAINYI 229
               ||||..:  |..|..|||||:..::.||:.||.::|... .|:|.||:..||||.|||
  Rat   226 ---KALQQTR--RLLANARERTRVHTISAAFEALRKQVPCYS-YGQKLSKLAILRIACNYI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sageNP_524287.1 HLH 181..233 CDD:278439 23/49 (47%)
Atoh8NP_001102711.1 HLH 232..283 CDD:278439 23/52 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.