DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sage and NEUROG1

DIOPT Version :9

Sequence 1:NP_524287.1 Gene:sage / 41105 FlyBaseID:FBgn0037672 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_006152.2 Gene:NEUROG1 / 4762 HGNCID:7764 Length:237 Species:Homo sapiens


Alignment Length:147 Identity:49/147 - (33%)
Similarity:67/147 - (45%) Gaps:22/147 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 PPMYMSYSGGSIANSTEVDIAKEHNPAWREK---------AL--QMEKDYRRTACDRERTRMRDM 195
            ||........:|:.::||..|::.....|.:         ||  .:.:..|..|.||||.||.::
Human    44 PPAPARRGAPNISRASEVPGAQDDEQERRRRRGRTRVRSEALLHSLRRSRRVKANDRERNRMHNL 108

  Fly   196 NRAFDLLRSKLPISKPNGKKYSKIESLRIAINYINHLQAMLRESSVGQNGNG---------CCAW 251
            |.|.|.|||.|| |.|:..|.:|||:||.|.|||..|...||.:..|..|.|         |...
Human   109 NAALDALRSVLP-SFPDDTKLTKIETLRFAYNYIWALAETLRLADQGLPGGGARERLLPPQCVPC 172

  Fly   252 SGGSSSPYDNGNDHWGA 268
            ..|..||..:. :.||:
Human   173 LPGPPSPASDA-ESWGS 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sageNP_524287.1 HLH 181..233 CDD:278439 28/51 (55%)
NEUROG1NP_006152.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 35..83 7/38 (18%)
HLH 90..149 CDD:238036 29/59 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..209 5/15 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.