powered by:
Protein Alignment sage and NEUROD1
DIOPT Version :9
Sequence 1: | NP_524287.1 |
Gene: | sage / 41105 |
FlyBaseID: | FBgn0037672 |
Length: | 268 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_002491.3 |
Gene: | NEUROD1 / 4760 |
HGNCID: | 7762 |
Length: | 356 |
Species: | Homo sapiens |
Alignment Length: | 65 |
Identity: | 31/65 - (47%) |
Similarity: | 38/65 - (58%) |
Gaps: | 3/65 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 174 LQMEKDYRRTACDRERTRMRDMNRAFDLLRSKLP-ISKPNGKKYSKIESLRIAINYINHLQAMLR 237
|:..|..|..|..|||.||..:|.|.|.||..:| .||. :|.||||:||:|.|||..|..:||
Human 96 LERFKLRRMKANARERNRMHGLNAALDNLRKVVPCYSKT--QKLSKIETLRLAKNYIWALSEILR 158
Fly 238 237
Human 159 158
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3898 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.