DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sage and myf6

DIOPT Version :9

Sequence 1:NP_524287.1 Gene:sage / 41105 FlyBaseID:FBgn0037672 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001003982.1 Gene:myf6 / 404208 ZFINID:ZDB-GENE-040309-2 Length:239 Species:Danio rerio


Alignment Length:173 Identity:47/173 - (27%)
Similarity:68/173 - (39%) Gaps:38/173 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 PTYSVIPQPVSMWHAGQVATGSPVGLECNKPSELVPPPMYMSYSGGSIANSTEVDIAKEHNPAWR 170
            |.|.....|:|   .||....|..|.|.:....::.||...::..|...             .|.
Zfish    32 PLYEGNDSPLS---PGQDPVPSETGCESSGEEHVLAPPGLQAHCEGQCL-------------MWA 80

  Fly   171 EKALQMEK---DYRRTACDRERTRMRDMNRAFDLLRSKLPISKPNGKKYSKIESLRIAINYINHL 232
            .|..:.:.   |.|:.|..|||.|::.:|.|||.|:.| .:..|| ::..|:|.||.|||||..|
Zfish    81 CKICKRKSAPTDRRKAATLRERRRLKKINEAFDALKKK-TVPNPN-QRLPKVEILRSAINYIEKL 143

  Fly   233 QAMLRESSVGQNGNGCCAWSGGSSSPY-----DN----GNDHW 266
            |.:|......:..|        .:.||     :|    ...||
Zfish   144 QDLLHSLDEQEQSN--------DTDPYTYNLKENHVTPSEYHW 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sageNP_524287.1 HLH 181..233 CDD:278439 23/51 (45%)
myf6NP_001003982.1 Basic 2..92 CDD:279868 14/75 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 28..59 9/29 (31%)
HLH 93..144 CDD:278439 23/52 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..239
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I5464
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.