DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sage and dimm

DIOPT Version :9

Sequence 1:NP_524287.1 Gene:sage / 41105 FlyBaseID:FBgn0037672 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster


Alignment Length:217 Identity:56/217 - (25%)
Similarity:84/217 - (38%) Gaps:60/217 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SGGSEGEAESSEQPV-------------LLELGAPQSSSCPAVSLNYTLTADGAGLLAYAPTHPH 84
            :|.|...||.|.:||             ..:|....|||....:.....:::|.|..... .||.
  Fly    35 NGLSSESAEGSSRPVRRATRRTSQLSNNTYDLEMTDSSSQSDDTSGGGGSSNGGGSTTNT-GHPS 98

  Fly    85 SYSPSVMGGYEKEAHNMGLLPPTYSVIPQPVSMWHAGQVATGSPVGLECNKPSELVPPPMYMSYS 149
            ..|   :||                  ..|.......|.::|:     |  ||.:.|        
  Fly    99 GCS---LGG------------------QGPSGRGRVQQASSGA-----C--PSTIAP-------- 127

  Fly   150 GGSIANSTEVDIAKEHNPAWREK--ALQ-MEKDYRR-TACDRERTRMRDMNRAFDLLRSKLPISK 210
                 |||..:.:..:..|.|.:  ||. .|::.|| .:.:|||.||..:|.||..||..:|..:
  Fly   128 -----NSTSSNSSNANGNASRRRKGALNAKERNMRRLESNERERMRMHSLNDAFQSLREVIPHVE 187

  Fly   211 PNGKKYSKIESLRIAINYINHL 232
            .. ::.||||:|.:|.|||.:|
  Fly   188 ME-RRLSKIETLTLAKNYIINL 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sageNP_524287.1 HLH 181..233 CDD:278439 23/53 (43%)
dimmNP_001260674.1 HLH 154..208 CDD:238036 22/54 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.