DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sage and Oli

DIOPT Version :9

Sequence 1:NP_524287.1 Gene:sage / 41105 FlyBaseID:FBgn0037672 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001188830.1 Gene:Oli / 35066 FlyBaseID:FBgn0032651 Length:232 Species:Drosophila melanogaster


Alignment Length:275 Identity:65/275 - (23%)
Similarity:97/275 - (35%) Gaps:98/275 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GVPGDPPPVLVPVSATTGGPYLSGGSEGEAESSEQPVLLELGAPQSSSCPAVSLNYTLTADGA-G 74
            |.||.|....:|:..|..   :.||..                |..::.|..|:....|..|: |
  Fly     9 GFPGLPNHGHMPIPPTAN---MLGGQH----------------PAPTASPPQSVPGRRTPLGSVG 54

  Fly    75 LLAYAPTHPHSYSPSVMGGYEKEAHNMGLLPPTYSVIPQPVSMWHAGQVATGSPVGLECNKPSEL 139
            |                ||:..:...|...|||                        :.|||...
  Fly    55 L----------------GGFYAQGMGMSQQPPT------------------------DENKPGPS 79

  Fly   140 VP-PPM--------YMSYSGGSI--------ANSTEVDIAKEHNPAWREKALQMEKDYRRTACDR 187
            .| .|:        .::.|||:.        |:.:..:..|:.|        :..|..|.....|
  Fly    80 APEKPLSPTAAAIAAIAISGGTTTVAVSSGGASGSGSNSGKQKN--------RQGKTVRLNINAR 136

  Fly   188 ERTRMRDMNRAFDLLRSKLPIS-KPNGKKYSKIESLRIAINYI----NHLQAMLRESSVGQNGNG 247
            ||.||.|:|.|.|.|||.:|.: .|:.:|.|||.:|.:|.|||    |.|:.:.|..:..|:..|
  Fly   137 ERRRMHDLNDALDELRSVIPYAHSPSVRKLSKIATLLLAKNYILMQQNALEELRRLLAYIQSTTG 201

  Fly   248 CCAWSGGSSSPYDNG 262
                    ::|.|.|
  Fly   202 --------AAPLDLG 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sageNP_524287.1 HLH 181..233 CDD:278439 25/56 (45%)
OliNP_001188830.1 HLH 134..188 CDD:197674 25/53 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.