DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sage and MSGN1

DIOPT Version :9

Sequence 1:NP_524287.1 Gene:sage / 41105 FlyBaseID:FBgn0037672 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001099039.1 Gene:MSGN1 / 343930 HGNCID:14907 Length:193 Species:Homo sapiens


Alignment Length:205 Identity:51/205 - (24%)
Similarity:71/205 - (34%) Gaps:71/205 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PVLLELGAPQSSSCPAVSLNYTLTADGAGLLAYAPTHPHSYS----PSVMGGYEKEAHNMGLLPP 106
            |..|...:|..|..||.||                   .|||    |:|.|           ||.
Human    35 PFELNQASPSQSLSPAPSL-------------------ESYSSSPCPAVAG-----------LPC 69

  Fly   107 TYSVIPQPVSMWHAGQVATGSPVGLECNKPSELVP--------PPMYMSYSGGSIA-NSTEVDIA 162
            .:            |..::|...|......|.||.        .|.::...||..| ..|:|   
Human    70 EH------------GGASSGGSEGCSVGGASGLVEVDYNMLAFQPTHLQGGGGPKAQKGTKV--- 119

  Fly   163 KEHNPAWREKALQMEKDYRRTACDRERTRMRDMNRAFDLLRSKL-PISKPNGKKYSKIESLRIAI 226
                        :|....||.|.:||:.|||.:..|...||:.| |:....|:..:||::|:..|
Human   120 ------------RMSVQRRRKASEREKLRMRTLADALHTLRNYLPPVYSQRGQPLTKIQTLKYTI 172

  Fly   227 NYINHLQAML 236
            .||..|..:|
Human   173 KYIGELTDLL 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sageNP_524287.1 HLH 181..233 CDD:278439 20/52 (38%)
MSGN1NP_001099039.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..59 11/42 (26%)
HLH 125..179 CDD:278439 20/53 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149876
Domainoid 1 1.000 49 1.000 Domainoid score I11802
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.800

Return to query results.
Submit another query.