DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sage and ascl1b

DIOPT Version :10

Sequence 1:NP_524287.1 Gene:sage / 41105 FlyBaseID:FBgn0037672 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_571306.1 Gene:ascl1b / 30478 ZFINID:ZDB-GENE-980526-174 Length:195 Species:Danio rerio


Alignment Length:91 Identity:35/91 - (38%)
Similarity:49/91 - (53%) Gaps:14/91 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 DRERTRMRDMNRAFDLLRSKLPISKPNGKKYSKIESLRIAINYINHLQAMLRE----SSVGQNG- 245
            :|||.|::.:|..|..||..:|....| ||.||:|:||.|:.||..||.:|.|    |:|.|.| 
Zfish    73 ERERNRVKQVNMGFQTLRQHVPNGAAN-KKMSKVETLRSAVEYIRALQQLLDEHDAVSAVLQCGV 136

  Fly   246 ---NGCCAWSGGSSSPY-----DNGN 263
               :...|:|.|..||:     |.|:
Zfish   137 PSPSVSNAYSAGPESPHSAYSSDEGS 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sageNP_524287.1 bHLH_TS 181..236 CDD:381396 22/49 (45%)
ascl1bNP_571306.1 bHLH_SF 63..133 CDD:469605 26/60 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 141..164 7/22 (32%)

Return to query results.
Submit another query.