Sequence 1: | NP_524287.1 | Gene: | sage / 41105 | FlyBaseID: | FBgn0037672 | Length: | 268 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571116.1 | Gene: | neurog1 / 30239 | ZFINID: | ZDB-GENE-990415-174 | Length: | 208 | Species: | Danio rerio |
Alignment Length: | 224 | Identity: | 60/224 - (26%) |
---|---|---|---|
Similarity: | 79/224 - (35%) | Gaps: | 85/224 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 55 QSSSCPAVSLNYTLTADGAGLLAYAPTHPHSYSPSVMGGYEKEAHNMGLLPPTYSVIPQPVSMWH 119
Fly 120 AGQVATGSPVGLECNKPSELVPPPMYMSYSGGSIANSTEVDIAKEHNPAWREKALQMEKDYRRTA 184
Fly 185 CDRERTRMRDMNRAFDLLRSKLPISKPNGKKYSKIESLRIAINYINHLQAMLRESSVGQN----- 244
Fly 245 ----------------GNGCCAWSGGSSS 257 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sage | NP_524287.1 | HLH | 181..233 | CDD:278439 | 27/51 (53%) |
neurog1 | NP_571116.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..62 | 20/101 (20%) | |
CCDC106 | <20..>102 | CDD:292422 | 36/144 (25%) | ||
HLH | 68..127 | CDD:238036 | 30/73 (41%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 159..180 | 5/10 (50%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3898 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |