DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sage and Neurog2

DIOPT Version :9

Sequence 1:NP_524287.1 Gene:sage / 41105 FlyBaseID:FBgn0037672 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_008759703.1 Gene:Neurog2 / 295475 RGDID:1309061 Length:263 Species:Rattus norvegicus


Alignment Length:280 Identity:71/280 - (25%)
Similarity:97/280 - (34%) Gaps:107/280 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 EQPVLLELGAPQSSSCPAVSLNYTLTADGAGLLAYAPTHPHSYS-----------PSVMGGYEKE 97
            |:.||:.||    |:.||   :.|||             |.|.|           |....|....
  Rat    13 EEEVLMLLG----SASPA---SATLT-------------PMSSSADEEEDEELRRPGAARGQRGA 57

  Fly    98 AHNMGLLPPTYSVIPQPVSMWHAGQVATGSPVGL--ECNKPSELVPPPMYMSYSGGSIANSTEVD 160
            ....|:         |..|...||....|..:||  ||.:     .|....:.|.|         
  Rat    58 EAGQGV---------QGSSASGAGGCRPGRLLGLVHECKR-----RPSRARAVSRG--------- 99

  Fly   161 IAKEHNPAWREKALQMEKDYRRTACDRERTRMRDMNRAFDLLRSKLPISKPNGKKYSKIESLRIA 225
             ||.     .|...:::|..|..|.:|||.||.::|.|.|.||..|| :.|...|.:|||:||.|
  Rat   100 -AKT-----AETVQRIKKTRRLKANNRERNRMHNLNAALDALREVLP-TFPEDAKLTKIETLRFA 157

  Fly   226 INYINHLQAMLR------------------------ESSVGQNGNG---CCAW--------SGGS 255
            .|||..|...||                        .:::|.:|:.   ..:|        |..|
  Rat   158 HNYIWALTETLRLADHCAGGGSLQGALFSEAVLLSPGAALGASGDSPSPSSSWSCTNSPASSSNS 222

  Fly   256 SSPYD---------NGNDHW 266
            :|||.         :..|:|
  Rat   223 TSPYSCTLSPASPGSDVDYW 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sageNP_524287.1 HLH 181..233 CDD:278439 25/51 (49%)
Neurog2XP_008759703.1 HLH 110..169 CDD:238036 27/59 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.