DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sage and Mesp2

DIOPT Version :9

Sequence 1:NP_524287.1 Gene:sage / 41105 FlyBaseID:FBgn0037672 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001099743.1 Gene:Mesp2 / 293046 RGDID:1305959 Length:368 Species:Rattus norvegicus


Alignment Length:141 Identity:45/141 - (31%)
Similarity:62/141 - (43%) Gaps:22/141 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 PQPVSM-------------W--HAGQVATGSPVGLECNKPSELVPPPMYMSYSGGSIANSTEVDI 161
            |||.|:             |  |:...:..|......:.|.....||   |.|.|...::....:
  Rat     5 PQPQSLQGLDHWVFSQGWGWARHSDSTSPASSSDSSGSCPCYATRPP---SQSTGPARSARNTQV 66

  Fly   162 AKEHNPAWREKALQMEKDYRRTACDRERTRMRDMNRAFDLLRSKLPIS-KPNGKKYSKIESLRIA 225
            |..   |.|..........|::|.:||:.|||.:.||...||..||.| .|.|:..:|||:||:|
  Rat    67 APN---APRRARPAPAGGQRQSASEREKLRMRTLARALQELRRFLPPSVAPAGQSLTKIETLRLA 128

  Fly   226 INYINHLQAML 236
            |.||.||.|:|
  Rat   129 IRYIGHLSALL 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sageNP_524287.1 HLH 181..233 CDD:278439 26/52 (50%)
Mesp2NP_001099743.1 HLH 82..135 CDD:278439 25/52 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343766
Domainoid 1 1.000 49 1.000 Domainoid score I11472
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.800

Return to query results.
Submit another query.