DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sage and Bhlha15

DIOPT Version :10

Sequence 1:NP_524287.1 Gene:sage / 41105 FlyBaseID:FBgn0037672 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_034930.1 Gene:Bhlha15 / 17341 MGIID:891976 Length:197 Species:Mus musculus


Alignment Length:129 Identity:41/129 - (31%)
Similarity:59/129 - (45%) Gaps:31/129 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 NKP---------SELVP----PPMYMSYSGGS-----IANST--------EVDIAKEHNPAWREK 172
            |:|         :|..|    |....|.||||     :.:.|        ||...::.:...||.
Mouse     5 NRPPRRRTPMQDTEATPGEQTPDRPQSGSGGSELTKGLRSRTARASGGRGEVSRRRQGSGGRREN 69

  Fly   173 ALQMEKDYRRTACDRERTRMRDMNRAFDLLRSKLPISKPNGKKYSKIESLRIAINYINHLQAML 236
            ::|.    |..:.:|||.||..:|.||..||..:|..:.: ||.||||:|.:|.|||..|.|.:
Mouse    70 SVQR----RLESNERERQRMHKLNNAFQALREVIPHVRAD-KKLSKIETLTLAKNYIKSLTATI 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sageNP_524287.1 bHLH_TS 181..236 CDD:381396 25/54 (46%)
Bhlha15NP_034930.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..82 18/80 (23%)
bHLH_TS_MIST1 73..134 CDD:381554 25/61 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..197
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.