DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sage and Mesp1

DIOPT Version :10

Sequence 1:NP_524287.1 Gene:sage / 41105 FlyBaseID:FBgn0037672 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_032614.2 Gene:Mesp1 / 17292 MGIID:107785 Length:243 Species:Mus musculus


Alignment Length:181 Identity:48/181 - (26%)
Similarity:69/181 - (38%) Gaps:49/181 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 PTYSVIPQPVSMWHAGQVATGSPVGLECNKPSELVPPPMYMSYSGGSIANSTEVDIAKEHNPAWR 170
            |.:|..|     |...|.::.:|   .|.:|:.....|......|..:.:.              
Mouse    34 PAWSSDP-----WDGAQASSPAP---PCARPARRAGTPGRRGTHGSRLGSG-------------- 76

  Fly   171 EKALQMEKDYRRTACDRERTRMRDMNRAFDLLRSKLPIS-KPNGKKYSKIESLRIAINYINHLQA 234
                     .|::|.:||:.|||.:.||...||..||.| .|.|:..:|||:||:||.||.||.|
Mouse    77 ---------QRQSASEREKLRMRTLARALHELRRFLPPSVAPTGQNLTKIETLRLAIRYIGHLSA 132

  Fly   235 ML---------RESSVGQNGNGCCAWS--------GGSSSPYDNGNDHWGA 268
            :|         :..:|...|...|..|        |...||.......||:
Mouse   133 VLGLSEDNLRRQRHAVSPRGCPLCPDSDLAQSQSLGPRLSPAVCSGVSWGS 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sageNP_524287.1 bHLH_TS 181..236 CDD:381396 28/55 (51%)
Mesp1NP_032614.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..86 13/82 (16%)
bHLH_SF 77..141 CDD:469605 29/63 (46%)
CPLCP 153..157 0/3 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..228
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.