DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sage and Mesp1

DIOPT Version :9

Sequence 1:NP_524287.1 Gene:sage / 41105 FlyBaseID:FBgn0037672 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_032614.2 Gene:Mesp1 / 17292 MGIID:107785 Length:243 Species:Mus musculus


Alignment Length:181 Identity:48/181 - (26%)
Similarity:69/181 - (38%) Gaps:49/181 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 PTYSVIPQPVSMWHAGQVATGSPVGLECNKPSELVPPPMYMSYSGGSIANSTEVDIAKEHNPAWR 170
            |.:|..|     |...|.::.:|   .|.:|:.....|......|..:.:.              
Mouse    34 PAWSSDP-----WDGAQASSPAP---PCARPARRAGTPGRRGTHGSRLGSG-------------- 76

  Fly   171 EKALQMEKDYRRTACDRERTRMRDMNRAFDLLRSKLPIS-KPNGKKYSKIESLRIAINYINHLQA 234
                     .|::|.:||:.|||.:.||...||..||.| .|.|:..:|||:||:||.||.||.|
Mouse    77 ---------QRQSASEREKLRMRTLARALHELRRFLPPSVAPTGQNLTKIETLRLAIRYIGHLSA 132

  Fly   235 ML---------RESSVGQNGNGCCAWS--------GGSSSPYDNGNDHWGA 268
            :|         :..:|...|...|..|        |...||.......||:
Mouse   133 VLGLSEDNLRRQRHAVSPRGCPLCPDSDLAQSQSLGPRLSPAVCSGVSWGS 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sageNP_524287.1 HLH 181..233 CDD:278439 26/52 (50%)
Mesp1NP_032614.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..86 13/82 (16%)
HLH 77..130 CDD:278439 25/52 (48%)
CPLCP 153..157 0/3 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..228
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839920
Domainoid 1 1.000 50 1.000 Domainoid score I11580
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5450
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.830

Return to query results.
Submit another query.