DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sage and Hand1

DIOPT Version :10

Sequence 1:NP_524287.1 Gene:sage / 41105 FlyBaseID:FBgn0037672 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_032239.1 Gene:Hand1 / 15110 MGIID:103577 Length:216 Species:Mus musculus


Alignment Length:167 Identity:42/167 - (25%)
Similarity:64/167 - (38%) Gaps:36/167 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 PTHPHSYSPSVMG-----GYEKEAHNMGLLPPTYSVIPQPVSMWHAGQVATGSPVGLECNKPSEL 139
            |.||..:.|.:.|     ..|:......||.|              ...|...|.|         
Mouse    18 PPHPMLHEPFLFGPASRCHQERPYFQSWLLSP--------------ADAAPDFPAG--------- 59

  Fly   140 VPPPMYMSYSGGSIANSTEVDIAKEHNPAWREKALQMEKDYRR-TACDRERTRMRDMNRAFDLLR 203
            .|||.      .::|.:.....|:......|.:||......|: :...:||.|...:|.||..||
Mouse    60 GPPPT------TAVAAAAYGPDARPSQSPGRLEALGSRLPKRKGSGPKKERRRTESINSAFAELR 118

  Fly   204 SKLPISKPNGKKYSKIESLRIAINYINHLQAMLRESS 240
            ..:| :.|...|.|||::||:|.:||.:|..:|.:.:
Mouse   119 ECIP-NVPADTKLSKIKTLRLATSYIAYLMDVLAKDA 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sageNP_524287.1 bHLH_TS 181..236 CDD:381396 21/55 (38%)
Hand1NP_032239.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..109 15/70 (21%)
bHLH_TS_HAND1 94..153 CDD:381522 22/59 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..203
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.