DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment sage and MESP2

DIOPT Version :9

Sequence 1:	NP_524287.1	Gene:	sage / 41105	FlyBaseID:	FBgn0037672	Length:	268	Species:	Drosophila melanogaster
Sequence 2:	NP_001035047.1	Gene:	MESP2 / 145873	HGNCID:	29659	Length:	397	Species:	Homo sapiens

Alignment Length:	78	Identity:	34/78 - (43%)
Similarity:	46/78 - (58%)	Gaps:	7/78 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly   181 RRTACDRERTRMRDMNRAFDLLRSKLPIS-KPNGKKYSKIESLRIAINYINHLQAM--LRESSV- 241
            |::|.:||:.|||.:.||...||..||.| .|.|:..:|||:||:||.||.||.|:  |.|.|:
Human    83 RQSASEREKLRMRTLARALHELRRFLPPSLAPAGQSLTKIETLRLAIRYIGHLSAVLGLSEESLQ 147

  Fly   242 ---GQNGNGCCAW 251
               .|.|:....|
Human   148 CRRRQRGDAGSPW 160

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
sage	NP_524287.1	HLH	181..233	CDD:278439	26/52 (50%)
MESP2	NP_001035047.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	28..92		4/8 (50%)
		HLH	82..135	CDD:278439	25/51 (49%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	152..208		3/9 (33%)
		13 X 2 AA tandem repeats of G-Q	179..204
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	222..295
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	351..376
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165149875
Domainoid	1	1.000	49	1.000	Domainoid score	I11802
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	1	0.960	-	-
User_Submission	0	0.000	Not matched by this tool.
	4	3.800