DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sage and OLIG2

DIOPT Version :9

Sequence 1:NP_524287.1 Gene:sage / 41105 FlyBaseID:FBgn0037672 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_005797.1 Gene:OLIG2 / 10215 HGNCID:9398 Length:323 Species:Homo sapiens


Alignment Length:276 Identity:68/276 - (24%)
Similarity:100/276 - (36%) Gaps:93/276 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLSSTAGVPGDPPPVLVPV-SATTGGPYLSGGSEGEAESSEQPVLLELGAPQSSSCPAVSLNYTL 68
            |:||....| :|..:.:|. |..:.|...:||:    .||..|          |.||.     .|
Human     7 LVSSRPSSP-EPDDLFLPARSKGSSGSAFTGGT----VSSSTP----------SDCPP-----EL 51

  Fly    69 TADGAGLLAYAPTHPHSYSPSVMGGYEKEAHNMGLLPPTYSVIPQPVSMWHAGQVATGSPVGLEC 133
            :|:..|.:..|..||                                     |....||  |.:.
Human    52 SAELRGAMGSAGAHP-------------------------------------GDKLGGS--GFKS 77

  Fly   134 NKPSELVPPPMYMSYSGGSIANSTEVDIAKEHNPAWREKALQMEKDYRRTACDRERTRMRDMNRA 198
            :..|.       .|.:..:.|:||:.|..:...|..::..|::.        .|||.||.|:|.|
Human    78 SSSST-------SSSTSSAAASSTKKDKKQMTEPELQQLRLKIN--------SRERKRMHDLNIA 127

  Fly   199 FDLLRSKLPISK-PNGKKYSKIESLRIAINYI----NHLQAMLRESS-------VGQNGNGCCAW 251
            .|.||..:|.:. |:.:|.|||.:|.:|.|||    |.|:.|.|..|       .|.:.:.|   
Human   128 MDGLREVMPYAHGPSVRKLSKIATLLLARNYILMLTNSLEEMKRLVSEIYGGHHAGFHPSAC--- 189

  Fly   252 SGG--SSSPYDNGNDH 265
             ||  .|:|......|
Human   190 -GGLAHSAPLPAATAH 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sageNP_524287.1 HLH 181..233 CDD:278439 23/56 (41%)
OLIG2NP_005797.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..107 33/165 (20%)
bHLH_TS_OLIG2 95..179 CDD:381510 30/91 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.