DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sage and LOC101732842

DIOPT Version :9

Sequence 1:NP_524287.1 Gene:sage / 41105 FlyBaseID:FBgn0037672 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_004912702.1 Gene:LOC101732842 / 101732842 -ID:- Length:278 Species:Xenopus tropicalis


Alignment Length:136 Identity:41/136 - (30%)
Similarity:66/136 - (48%) Gaps:11/136 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 IPQPVSM---WHAGQVATGSPVGLECN---KP--SELVPP-PMYMSYSGGSIANSTEVDIAKEHN 166
            :||..|.   |......:.||.....:   .|  :.|.|| ..:.:|....:.:.|... .:|..
 Frog     1 MPQDCSQTFEWAYASSCSESPASSSDSYSLSPGYAHLAPPKETFCNYHQAQVYDMTSHQ-TQESP 64

  Fly   167 PAWREKALQMEKDYRRTACDRERTRMRDMNRAFDLLRSKLPIS-KPNGKKYSKIESLRIAINYIN 230
            ...|....:|....|::|.:||:.|||::::|...||..||.| .|.|:..:|||:||:.|.||:
 Frog    65 QGSRRTRCRMVGPQRQSASEREKMRMRNLSKALQNLRRYLPPSVVPAGRTLTKIETLRLTIRYIS 129

  Fly   231 HLQAML 236
            ||.::|
 Frog   130 HLSSLL 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sageNP_524287.1 HLH 181..233 CDD:278439 24/52 (46%)
LOC101732842XP_004912702.1 bHLH_TS_Mesp 78..142 CDD:381508 26/58 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11597
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.